E-mail: [email protected] | Add: tips, tricks and guides  

Find my Parked Car Mini Forum, Answers, Tips, Tricks and Glitches

Ask a Question or Help other Players by Answering the Questions on the List Below:
Find my Parked Car icon

Rate this app:



More details

For Android: 5.0 Guide: Find my Parked Car cheats tutorial
When updated: 2022-08-25 Star Rating: 4.875
Name: Find my Parked Car hack for android Extension: Apk
Author: Lontyle Apps & Games File Name: com.lontylegames.simpleparkingappfree
Current Version: 2 User Rating: Everyone
Downloads: 1000-1275 Version: mod, apk, unlock
System: Android Type: Education

 


Share Find my Parked Car Cheats Guides Hints And Tutorials - Best Tactics from Users below.

Find my Parked Car Tricks and Codes:

Please wait 10 seconds



Find my Parked Car Hack Cheats Codes Tips Tricks Advices for New Users and Q&A!

Add your questions or answers

Q: How to get the best score?


Q: What is your favourite trick in this game/app?


Q: What is your strategy?



Watch Find my Parked Car videoreviews, gameplays, videoinstructions, tutorials, guides, tips and tricks recorded by users, pro players and testers.

Find my Parked Car Gameplay, Trailers and Related Videos

Watch How to Find your Parked Car on Google Maps (Works in 2022) video.

Find my Parked Car related image

Watch How to Use Your iPhone to Find Your Parked Car video.

Find my Parked Car related image

Watch New Google Maps feature help you find out your car parked location video.

Find my Parked Car related image

Watch Find your parked car with an apple watch video.

Find my Parked Car related image

Watch How to Show Parked Car on iPhone in iOS 16 or Later video.

Find my Parked Car related image

Watch How to Show Location of Parked Car on iPhone Maps - how to see parked car location in apple maps? video.

Find my Parked Car related image

Watch How to Find your Parked Car on Google Maps 2022 video.

Find my Parked Car related image

Watch HOW TO FIND YOUR PARKED CAR ON IPHONE MAPS video.

Find my Parked Car related image

Watch Find Your Parked Car With Your iPhone (#1274) video.

Find my Parked Car related image

Watch Finding your parked car just got easier with Google | Google Can Help You Find Your Parked Car video.

Find my Parked Car related image

 

About the application:

Search Parked Vehicle Locator Forgot where you left your vehicle? This Vehicle Parking Locator Apk will assist you Search my Parked Vehicle, Locate Parking and Search my current Place, by saving the exact parking location! With one easy click your place will be saved! When you wish to retrieve the parking place simply begin the apk and you will be able to retrieve the parking spot of your vehicle with high precision! Super Simple And Intuitive UI This apk has one of the easiest and fastest UI ever! Helping you save the parking place super simple and fast! High Precision GPS Coordinates This apk also has the most advanced GPS coordinate system, so when you save parking spot you will have the most accurate data as possible. Features ✪ Ultra Quick Save Parking Place ✪ GPS Coordinates locator ✪ Helps you receive your current GPS coordinates ✪ Ultra High precision GPS Parking Place Searcher ✪ Parking History

Find my Parked Car Hack - Gallery:

Find my Parked Car screenshot Find my Parked Car screenshot Find my Parked Car screenshot
Find my Parked Car hack free android guides videoreviews photos and help from pro players.
Changes in Find my Parked Car:
Initial Release
Download apk from Google Play

Reviews and Recent Comments:

  • Azzo Mayer: This is very awesome apk
    User rated this game 5/5 on 2022-01-23


  • Fenfang Yan: This is such a awesome apk. I would definitely suggest it to my mates
    User rated this game 5/5 on 2022-01-24


  • Arsh Al Adi: Cool! It really does what it promises. One of the best and easiest vehicle parking apks I have used so far. Thanks to the dev!
    User rated this game 5/5 on 2022-01-26


  • Jayden Rosario: It Works Good!
    User rated this game 5/5 on 2022-01-24


  • Krishiv Khatun: excelent, very awesome
    User rated this game 5/5 on 2022-01-24


  • Sohan Hossain: This is really nice, working well and it seems that the pro ver will be far better. Good job, well done!
    User rated this game 5/5 on 2022-01-26


  • Katelyn Clark: I like how this apk is designed. Thanks to dev
    User rated this game 5/5 on 2022-01-22



Tags:

Find my Parked Car cheats online
Hack Find my Parked Car
Cheat Find my Parked Car
Find my Parked Car Hack download
Each visitor is able to add own tips, cheats and hacks, tricks and solutions for any mobie app. Write questions and wait for the answer from other players. No registration required!
Describe your the best way to win the game, to get an advantage quickly and earn resources in the application as fast as possible. Help other android users to get better gameplay.
Do you like this app/game? Do not forget to write review and rate this item. Leave feedback and tell us how you rate graphics, gameplay and music. Vote for apps!
Before you device to test any game or app, simply watch some reviews/tutorials/gameplays on youtube. We deliver all related videos ready to watch.
See the gallery, app description, statistics and changelog. Find promo codes and easter eggs. Meet more players and create a team!

 

Recently Added:
Cropography icon Cropography
Breathing Domain: Attack icon Breathing Domain: Attack
Flip Card Game icon Flip Card Game
Sprunki Transformer Monster icon Sprunki Transformer Monster
Sprunki Hide: Monster Hunt icon Sprunki Hide: Monster Hunt
Color Pop - Paint & Coloring icon Color Pop - Paint & Coloring
Golden Surveys - Make Money icon Golden Surveys - Make Money
Nintendo Today! icon Nintendo Today!
Adorable Garden icon Adorable Garden
Cookingdom icon Cookingdom

 

New answers:
AI Pro Trading Signal
Fashion Journey : Merge Story
EVADE
SENTENCE BUILDER
Love Choices - Merge&Makeover
Fortune Gems-TaDa Games
Hailey's Treasure Game Tips
Matchpub
Simple sentence builder
PG Slot Myanmar

 

Random Cheats:
Fruit Cut 3D icon Fruit Cut 3D Hacks
Dragons Chest icon Dragons Chest Hacks
deathigner icon deathigner Hacks
WorldCraft – New Crafting game 2021 icon WorldCraft – New Crafting game 2021 Hacks
4X4 Off Road Drive icon 4X4 Off Road Drive Hacks
Xero Hour icon Xero Hour Hacks
Mobile Ghost Hunt: Phasmophobia Multiplayer Fear icon Mobile Ghost Hunt: Phasmophobia Multiplayer Fear Hacks
Ultimate Car stunts Simulator - Mega Ramp Racing icon Ultimate Car stunts Simulator - Mega Ramp Racing Hacks
Legend of Heroes:Eternal Arena icon Legend of Heroes:Eternal Arena Hacks
Домино 2021 - New Online Domino icon Домино 2021 - New Online Domino Hacks

 

Last Added Tricks:
Viidure-Dashcam Viewer Cheats
AI Food Tracker - BitePal Cheats
One UI 7 Widgets Cheats
Radish Rush: Save the Girl Cheats
Tidy Master Cheats
Cozy - Happy with AI Girl/Boy Cheats
BitTycoon: BTC Cloud Mining Cheats
Colorwood Words Puzzle Game Cheats
Low Go Cheats
Aquarium Crush Cheats

READ GUIDES, CHEATS AND TUTORIALS

Share you own hack tricks, advices and fixes. Write review for each tested game or app. Great mobility, fast server and no viruses. Each user like you can easily improve this page and make it more friendly for other visitors. Leave small help for rest of app' users. Go ahead and simply share funny tricks, rate stuff or just describe the way to get the advantage. Thanks!


Welcome on the best website for android users. If you love mobile apps and games, this is the best place for you. Discover cheat codes, hacks, tricks and tips for applications.

The largest android library

We share only legal and safe hints and tricks. There is no surveys, no payments and no download. Forget about scam, annoying offers or lockers. All is free & clean!

No hack tools or cheat engines
hack-cheat.org | 2018 All Rights Reserved.